PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Pbr013603.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Maloideae; Maleae; Pyrus
Family Nin-like
Protein Properties Length: 253aa    MW: 28848.9 Da    PI: 4.9239
Description Nin-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Pbr013603.1genomeCPETRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1RWP-RK81.58.4e-26142190452
       RWP-RK   4 eisledlskyFslpikdAAkeLgvclTvLKriCRqyGIkRWPhRkiksl 52 
                   ++l++++kyF+ pi++AAkeL+v+lTvLKr+CR+++I+RWPhRk++sl
  Pbr013603.1 142 PLELDEIQKYFDVPITQAAKELKVGLTVLKRRCRELNIMRWPHRKLRSL 190
                  6899*******************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5151917.052125211IPR003035RWP-RK domain
PfamPF020422.5E-23143190IPR003035RWP-RK domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009793Biological Processembryo development ending in seed dormancy
GO:0005634Cellular Componentnucleus
Sequence ? help Back to Top
Protein Sequence    Length: 253 aa     Download sequence    Send to blast
MADSIFSQYL VPKIETDPHE FNSSIPYYQD PCQDQSQFTS PPLPLQYNPN QLPQMGSQDF  60
EDLGIWDYIL DDAALPSPFD YEVVDENPLT TMAESIVCSN SVSGDSGDVF RMLDWGMESW  120
GKYDGEGMTK NGSCSKRMSA APLELDEIQK YFDVPITQAA KELKVGLTVL KRRCRELNIM  180
RWPHRKLRSL NALIENVKGM GLTNELRMLE EHKRLLEQLP DMELPERAKR LRQACFKANY  240
KKKRTLCLTA GP*
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009352035.10.0PREDICTED: protein RKD4-like
TrEMBLA0A061G1541e-62A0A061G154_THECC; RWP-RK domain-containing protein, putative
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF68983247
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G53040.13e-44RWP-RK domain-containing protein